TEL: +86 571 56623320    EMAIL: SALES@SUNLONGBIOTECH.COM

Recombinant mouse transforming growth factor β2 (TGF-β2), mouse Recombinant
Recombinant mouse transforming growth factor β2 (TGF-β2), mouse Recombinant
Total
(Vip priceV)
Regular members: $320.0
  • NO.:RS001
    Storage:-20℃/4℃
    Titer:5 x 106units/mg
  • Goods click count:137
  • Product Spec:
  • Quantity: - +
  • Limit points for buying:0 Points
  • Manual
  • Add to cart Inquiry Add to favorite
View History [Clear]

Details

Transforming growth factor β2(TGF-β2), a member of the TGF-β superfamily, has a typical cysteine structure. The TGF-β2-deficient mouse had developmental defects in the heart, lungs, craniofacial, limbs, spine, eyes, inner ear, and genitourinal system. All TGF-β subtypes signal through the same receptor heteromeric complex, which consists of a ligand-bound TGF-β type II receptor (TβR-II) and a TGF-β type I receptor (TβR-I). Signal transduction from the receptor to the nucleus is mediated by SMADs. Expression of TGF-β has been found in cartilage, bones, teeth, muscles, heart, blood vessels, hematopoietic cells, lungs, kidneys, intestines, liver, eyes, ears, skin, and nervous system.Recombinant mouse Transforming Growth factor β2(TGF-β2) is a 112 amino acid polypeptide chain with a molecular mass of 12.7kDa.

 

Alias:Transforming growth factor beta-2 (TGF-β2), Mouse, RABBIT; transforming growth factor beta-2 (TGF-β2), mouse, RABBIT; TGFB2;  BSC-1 cell growth inhibitor;  Cetermin;  Glioblastoma-derived T-cell suppressor factor;  G-TSF;  MGC116892;  Polyergin;  TGF-beta2;  TGF-beta-2;  transforming growth factor beta-2

 

Physical properties and indexes:

Purity: >95%

Endotoxin: <1 EU/μg

Titer: >5 x 106units/mg

Expression host: Human Cells

Source: Mouse

Purification Method: purification by chromatography

Character: This product is white loose body

Stability: The freeze-dried powder can be stored at -20℃ for 12 months, the dissolved liquid can be stored at -20℃ for 3 months, and at 4℃ for 1 week, and avoid repeated freeze-thaw

Amino acid sequence:

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS

 

 

Usage and Description: Scientific research reagent, widely used in cell biology, pharmacology and other scientific research, is strictly prohibited for human body. TGF-β2 has four basic activities: it is a growth inhibiting factor for most cell types; Enhanced extracellular matrix deposition; It can inhibit the expression of IL-12 and CD40L in antigen-presenting cells and up-regulate the secretion of IL-10. During embryonic development, it is expressed in discrete areas, such as epithelium, myocardium, cartilage and bone of hands and feet, and nervous system, suggesting that it has specific functions.

 

Instructions for use:

It is recommended that the vial be centrifuged briefly before opening to remove the contents from the bottom. It is recommended to dissolve freeze-dried powder in water for injection, sterilized ultra-pure water or PBS with a concentration of 100μg/ml. Reserve solution should be stored in separate packages for further dilution to working concentration. Avoid repeated freeze-thaw as much as possible.

After resolution, cytokines could be stably stored at 4℃ for 1 week. For short-term storage, please store at -20℃ after repackaging.

Attention

Our company can only provide partial information for some products, and we do not guarantee the authority of the information provided. The above data are only for reference and research.

This product is only used for scientific research by professionals, and shall not be used for clinical diagnosis or treatment, food or medicine, or stored in ordinary residences.

For your safety and health, please wear a lab coat and disposable gloves.

 

Our products are only for research purposes (non-clinical research).

 

 

Bought notes(bought amounts latest0)

No one bought this product
Total 0 records, divided into1 pages First Prev Next Last

User Comment(Total0User Comment Num)

  • No comment
Total 0 records, divided into1 pages First Prev Next Last
Username: Anonymous user
E-mail:
Rank:
Content:
Verification code: captcha

Call us

+86 571 56623320

Address

Room 1-315, Kongle Changqing Building, No. 160 Guangye Road,Gongshu District, Hangzhou City, Zhejiang Province, China

Join Us with

Leave a message
* To protect against spam, please pass the CAPTCHA test below.