TEL: +86 571 56623320    EMAIL: [email protected]

Recombinant Transforming growth factor beta-3 (TGF-β3), Human Recombinant
Recombinant Transforming growth factor beta-3 (TGF-β3), Human Recombinant
Total
(Vip priceV)
Regular members: $320.0
View History [Clear]

Details

Recombinant human transforming growth factor β3(TGF-β3);

Transforming growth factor beta-3 (TGF-β3), Human, Recombinant

Brief introduction:

Transforming growth factor β3(TGF-β3) belongs to the TGF-β family. It is a multifunctional cytokine with a variety of cellular functions, regulating cell proliferation, growth, differentiation and motility, as well as extracellular matrix synthesis and deposition. TGF-β3 is involved in cell differentiation, embryogenesis and development. It is believed to regulate cell adhesion and extracellular matrix (ECM) formation during palate development. Without TGF-β3, mammals develop a deformity called cleft palate.

Recombinant human TGF-β3 produced by mammalian expression systems is a 112 amino acid polypeptide chain with a molecular mass of 12.7kDa.

Alisas:Transforming growth factor beta-3 (TGF-β3), Human, RABBIT, transforming growth factor beta-3 (TGF-β3) TGFB3;  TGF-beta-3;  Latency-associated peptide;  LAP

Physical properties and indexes:

Purity: >95%

Endotoxin: <1 EU/μg

Titer: >5 x 106units/mg

Expression host: Human Cells

Source: Human

Purification Method: purification by chromatography

Character: white loose body

Stability: The freeze-dried powder can be stored at -20℃ for 12 months, the dissolved liquid can be stored at -20℃ for 3 months and at 4℃ for 1 week. For long-term storage, it is recommended to add carrier proteins (e.g. 0.1%BSA) and avoid repeated freeze-thaw

Amino acid sequence:

Ala301-Ser412(Accession #: P10600);

ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS


Usage and Description: Scientific research reagent, widely used in cell biology, pharmacology and other scientific research, is strictly prohibited for human body. TGF-β3 stimulates extracellular matrix synthesis of target cells (fibroblasts, vascular endothelial cells, etc.) during tissue repair and accelerates vascularization process, promotes wound healing and reduces scar formation. TGF-β3 can promote morphogenesis and play an important role in spine formation, limb germination, tooth emergence, facial bone formation and heart valve formation during mammalian embryonic development. TGF-β3 regulates bone formation and can affect adult bone regeneration.

Generally, tendon tissue is difficult to be cultured in vitro, but the proliferation and differentiation of tendon cells can be maintained in vitro by adding 10 ng/ml TGF-β3 and 50 ng/ml IGF-1 without fetal bovine serum.

Instructions for use:

It is recommended that the vial be centrifuged briefly before opening to remove the contents from the bottom. It is recommended to dissolve freeze-dried powder in water for injection or sterilized ultra-pure water with a concentration of 100μg/ml. Reserve solution should be stored in separate packages for further dilution to working concentration. Avoid repeated freeze-thaw as much as possible.

After resolution, cytokines could be stably stored at 4℃ for 1 week. For short-term storage, please store at -20℃ after repackaging.

【 Attention 】

Our company can only provide partial information for some products, and we do not guarantee the authority of the information provided. The above data are only for reference and research.

This product is only used for scientific research by professionals, and shall not be used for clinical diagnosis or treatment, food or medicine, or stored in ordinary residences.

For your safety and health, please wear a lab coat and disposable gloves.


Our products are only for research purposes (non-clinical research).

References (0)

No References

Bought notes(bought amounts latest0)

No one bought this product
Total 0 records, divided into1 pages First Prev Next Last

User Comment(Total0User Comment Num)

  • No comment
Total 0 records, divided into1 pages First Prev Next Last
Username: Anonymous user
E-mail:
Rank:
Content:
Verification code: captcha

Call us

+86 571 56623320

Address

Room 1-315, Kongle Changqing Building, No. 160 Guangye Road,Gongshu District, Hangzhou City, Zhejiang Province, China

Join Us with

Leave a message
* To protect against spam, please pass the CAPTCHA test below.