TEL: +86 571 56623320 EMAIL: [email protected]
Recombinant human transforming growth factor β2(TGF-β2); Human, Recombinant
Brief introduction:
Transforming Growth factor β2(TGF-β2) is a secreted protein belonging to the TGF-β family. It is a cytokine that has a variety of cellular functions and plays a crucial role in embryonic development. It also inhibits the action of interleukin-dependent T-cell tumors. TGF-β2 is an extracellular glycosylated protein. Loss of TGF-β2 may be a cause of non-syndromic aortic disease (NSAD). Expression of TGF-β has been found in cartilage, bones, teeth, muscles, heart, blood vessels, hematopoietic cells, lungs, kidneys, intestines, liver, eyes, ears, skin, and nervous system.
Recombinant Human Transforming Growth factor β2(TGF-β2) is a 112 amino acid polypeptide chain with a molecular mass of 12.7kDa.
Alisas:Transforming growth factor beta-2 (TGF-β2), Human, RABBIT, transforming growth factor beta-2 (TGF-β2) Polyergin; G-TSF; Glioblastoma-derived T-cell suppressor factor; Cetermin; BSC-1 cell growth inhibitor; TGF-beta-2
Physical properties and indexes:
Purity: >95%
Endotoxin: <1 EU/μg
Titer: >5 x 106units/mg
Expression host: Human Cells
Source: Human
Purification Method: purification by chromatography
Character: white loose body
Stability: The freeze-dried powder can be stored at -20℃ for 12 months, the dissolved liquid can be stored at -20℃ for 3 months and at 4℃ for 1 week. For long-term storage, it is recommended to add carrier proteins (e.g. 0.1%BSA) and avoid repeated freeze-thaw
Amino acid sequence:
Ala303-Ser414(Accession #: P61812);
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Usage and Description:
Scientific research reagent, widely used in cell biology, pharmacology and other scientific research, is strictly prohibited for human body. TGF-β2 has four basic activities: it is a growth inhibiting factor for most cell types; Enhanced extracellular matrix deposition; It can inhibit the expression of IL-12 and CD40L in antigen-presenting cells and up-regulate the secretion of IL-10. During embryonic development, it is expressed in discrete areas, such as epithelium, myocardium, cartilage and bone of hands and feet, and nervous system, suggesting that it has specific functions.
Instructions for use:
It is recommended that the vial be centrifuged briefly before opening to remove the contents from the bottom. It is recommended to dissolve freeze-dried powder in water for injection or sterilized ultra-pure water with a concentration of 100μg/ml. Reserve solution should be stored in separate packages for further dilution to working concentration. Avoid repeated freeze-thaw as much as possible.
After resolution, cytokines could be stably stored at 4℃ for 1 week. For short-term storage, please store at -20℃ after repackaging.
【 Attention 】
Our company can only provide partial information for some products, and we do not guarantee the authority of the information provided. The above data are only for reference and research.
This product is only used for scientific research by professionals, and shall not be used for clinical diagnosis or treatment, food or medicine, or stored in ordinary residences.
For your safety and health, please wear a lab coat and disposable gloves.
Our products are only for research purposes (non-clinical research).
Username | Quantity | bought time |
Na*** | 2 | 2024-08-10 |
So*** | 2 | 2024-07-07 |
Um*** | 1 | 2024-04-19 |
Scan Wechat Qrcode
Scan Whatsapp Qrcode