TEL: +86 571 56623320    EMAIL: [email protected]

Rabbit Anti-GRPP antibody
Rabbit Anti-GRPP antibody
glicentin-related polypeptide; GCG; Glicentin related polypeptide; Glucagon precursor; GRPP; Oxyntomodulin; OXM; OXY; GLUC_HUMAN.
Total
(Vip priceV)
Regular members: $334.4
  • Save more [Favourable] 30% discount
  • NO.:SL10995R
    Clonality:Polyclonal
    Immunogen Species:Rabbit
    React Species:(predicted: Human,)
    Applications:ELISA
    concentration:1mg/ml
  • Goods click count:28
  • Product Spec:
  • Quantity: - +
  • Limit points for buying:0 Points
  • Manual
  • Add to cart Inquiry Add to favorite
View History [Clear]

Details

Product Name GRPP
Chinese Name 肠高血糖素相关肽抗体
Alias glicentin-related polypeptide; GCG; Glicentin related polypeptide; Glucagon precursor; GRPP; Oxyntomodulin; OXM; OXY; GLUC_HUMAN.  
Research Area Tumour  Cardiovascular  immunology  Neurobiology  Signal transduction  Channel protein  Diabetes  Endocrinopathy  The new supersedes the old  
Immunogen Species Rabbit
Clonality Polyclonal
React Species (predicted: Human, )
Applications ELISA=1:5000-10000 
not yet tested in other applications.
optimal dilutions/concentrations should be determined by the end user.
Theoretical molecular weight 3.3kDa
Cellular localization Secretory protein 
Form Liquid
Concentration 1mg/ml
immunogen KLH conjugated synthetic peptide derived from human GRPP(C-RSLQDTEEKSRSFSASQADPLSDPDQMNED): 21-50/180 
Lsotype IgG
Purification affinity purified by Protein A
Buffer Solution 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol.
Storage Shipped at 4℃. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles.
Attention This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications.
PubMed PubMed
Product Detail The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq].

Function:
Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.
GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.
Oxyntomodulin significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.
Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Subcellular Location:
Secreted.

Tissue Specificity:
Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain.

Post-translational modifications:
Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.

Similarity:
Belongs to the glucagon family.

SWISS:
P01275

Gene ID:
2641

Database links:

Entrez Gene: 2641 Human

Entrez Gene: 14526 Mouse

Entrez Gene: 24952 Rat

Omim: 138030 Human

SwissProt: P01272 Cow

SwissProt: P01275 Human

SwissProt: P01274 Pig

SwissProt: P06883 Rat

Unigene: 516494 Human

Unigene: 54383 Rat



Bought notes(bought amounts latest0)

No one bought this product
Total 0 records, divided into1 pages First Prev Next Last

User Comment(Total0User Comment Num)

  • No comment
Total 0 records, divided into1 pages First Prev Next Last
Username: Anonymous user
E-mail:
Rank:
Content:
Verification code: captcha

Call us

+86 571 56623320

Address

Room 1-315, Kongle Changqing Building, No. 160 Guangye Road,Gongshu District, Hangzhou City, Zhejiang Province, China

Join Us with

Leave a message
* To protect against spam, please pass the CAPTCHA test below.